PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10008685
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 683aa    MW: 75200 Da    PI: 6.8821
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10008685genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.7e-174087148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l+++vk+ G g+W+++ ++ g+ R++k+c++rw ++l
      Lus10008685 40 KGPWTAAEDAILIEYVKKNGEGNWNAVQKHSGLSRCGKSCRLRWANHL 87
                     79******************************************9986 PP

2Myb_DNA-binding53.65.3e-1793136146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE++l++++++++G++ W++ a++++ gRt++++k++w++
      Lus10008685  93 KGAFTQEEEQLIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 136
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4763587IPR017930Myb domain
SuperFamilySSF466898.99E-3137134IPR009057Homeodomain-like
SMARTSM007171.2E-153989IPR001005SANT/Myb domain
PfamPF002492.1E-154087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-244194IPR009057Homeodomain-like
CDDcd001671.94E-114287No hitNo description
PROSITE profilePS5129426.80788142IPR017930Myb domain
SMARTSM007172.3E-1792140IPR001005SANT/Myb domain
PfamPF002495.7E-1693136IPR001005SANT/Myb domain
CDDcd001671.59E-1295136No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2695142IPR009057Homeodomain-like
PfamPF139662.5E-8574639IPR026960Reverse transcriptase zinc-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 683 aa     Download sequence    Send to blast
MSHMTNESKD RFLANDQIES PLADEGNSSR KGNGETNLKK GPWTAAEDAI LIEYVKKNGE  60
GNWNAVQKHS GLSRCGKSCR LRWANHLRPN LKKGAFTQEE EQLIIELHAK MGNKWARMAA  120
HLPGRTDNEI KNYWNTRIKR RLRAGLPLYP PDLSSHSYRD NQWDLNIGGI NCGRKGHHEL  180
LHNCHEIPDA TFDSLKASQI RVSNSLPELA DINSSQMLIK GLGSSQYGSF ISPLMHSKKR  240
LRESTSSQLS GFNVNGRNDF SLFGFQNDLR EKATQSFGLS YPFDSDPNTK IQHRHGVGDD  300
QDRHTQSYGI FSASKPNSGA VKSELPSLQY TENDASSCWG ISSPPPLLES YDNFIQSLPT  360
GTVGSSYLSP RNSGLLDALL HEAKTLSTAK KHSSEKSSNS STVTPGDIAD SLSPNGHDPE  420
WDNYGDPLSP TATSYFSKRS TPISASGSSL DEQPPIETFT GCDSSVSRIE LVAGCDIKTE  480
ALTPERERDA VKRQPDALLD SDWLEQGSGG SYVKDQVVMT DAIAALLGDD LSSEYKQMAG  540
AGTSSGASQG WVLGSCTWNN MPPDKLLAKH AHVHWCALIR RGPCIPKHCF VAWLALHKRL  600
VKHSLMASWG LSLDIFCFLC SNGADELSHL TVDCDFRKTI RNFCLGRDDT LFLDWTDFVA  660
PFSSLHYGNR CVCLLGTAFL EG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-32341421108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136142RIKRRLR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012068750.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012068751.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012068752.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A067L7W60.0A0A067L7W6_JATCU; MYB family protein
STRINGPOPTR_0003s18900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-111myb domain protein 65